SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g39680.1|13105.m04185|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g39680.1|13105.m04185|protein
Domain Number 1 Region: 637-894
Classification Level Classification E-value
Superfamily EreA/ChaN-like 1.1e-34
Family ChaN-like 0.021
Further Details:      
 
Domain Number 2 Region: 92-212
Classification Level Classification E-value
Superfamily PX domain 3.01e-20
Family PX domain 0.0028
Further Details:      
 
Domain Number 3 Region: 268-412,440-502
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000994
Family Arfaptin, Rac-binding fragment 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g39680.1|13105.m04185|protein
Sequence length 1255
Comment PX domain containing protein, expressed
Sequence
MMAAEPSPAAASAVEDLETLPLDSSYSSAPATDPLLRPPASPSAASAAAGGDHDPFVIDD
DFLVDEEDDDDVGPPAPTAIPLVAAAARAPEFARIAVSDPKKHAEPTSGAAGVIPGSGSY
FSYLITTRVGEAEVRVRRRFRDVVALADRLAAAHRGLFIPARPDKSVVEGQVMQRHDFVN
QRCSALQRYLRRLAAHPVVGHSPDLRTFLTEPGAIPAFEGEQPRYWTTTLSSAAPSTPAK
AGRDLFGMFKGLKQTVVNGMVATKPPPVEEETDTEFLAHKARFQDLQQQLTTTSQQAEAL
VKARDDLRTTTAHLGMTLIKLAKFEREQATCSPQRRRAADINNFGSSVVKFSRSQAKLNS
EIVKHLGSIHEYLEMMISVHHAFTDRSNALHHVQSLSADLFFLHTRAEKLESVSSRSRSI
DQEWTRHQKLGGLKETISATEAAKSHALKEYENIKENNTIEIKRFDKDRRRDFVQMLKGF
IVNQVSYSDHYANMWAKVADETKVKLELSAAKMSHAPCRNAASFKPLLPSRLRAKPLAGI
SSSPRRNVSASAASSQSRRDFLLLIPSLAAASAILRPLPSSAADGEAPPTDSSSPSPPSA
EEAGAVVEEVDESALSRVYDATVIGEPEAVGKDARGRVWEKLTAARVVYLGEAELVPDPD
DRVLELEIMKGLATRCAEAERGVAVALEAFPCDLQQQLDQFMDGRIDGSILKLYTLHWPQ
DRWEEYEPLLNYCRDNGIKLIACGTPLEVKRTVQADGIRGLSKAERQEYAPPAGSGFISG
FSSISGRSLIDKISSARDSPFGPTSYLSAQARVVDDYTMSQIILKELNGGDTSRMLIVIT
GASHVIYGSRGIGVPARVSKKMPKKDQVVVLLDPERQSIRREGEIPVADFLWYSAAKPCS
RNCFDRAEIARVMNAAGRRPEALPQDLQKGIDLGVVSPEILQNFFDLEKYPVMSELIHRF
QGFRERLLADPKFLQRLAIEEAISITTTLLAQYERRKGRFFEEIDYVLTDTIRGSVVDFF
TVWLPAPTISVLSYADDGSGESLEFVKGLLGSLPDNAFQKNVLGQNWNMKQRVAAVLVGG
LKLASVGFISSVGAGASSDLLYAARGVLKSSVNAEAGRKRSPIWKSAAVYSCFLGTSANL
RYQIIAGLVEHRLGESLATSYNQPLLASLLSFVARTVNSYWGTQQWVDLARYTGLQKTKE
VPPVEATAPPAETSQLATPPAETSQLATPPAETSQLEDGRTEVQNLDDNSNQSSG
Download sequence
Identical sequences A0A0E0PNV8
LOC_Os05g39680.1|13105.m04185|protein 39947.LOC_Os05g39680.1 LOC_Os05g39680.1|PACid:21939833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]