SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g13060.1|13106.m01438|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g13060.1|13106.m01438|protein
Domain Number 1 Region: 21-93
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-27
Family Chaperone J-domain 0.00031
Further Details:      
 
Weak hits

Sequence:  LOC_Os06g13060.1|13106.m01438|protein
Domain Number - Region: 296-361
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00558
Family FCH domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g13060.1|13106.m01438|protein
Sequence length 435
Comment heat shock protein DnaJ, putative, expressed
Sequence
MAGSRFGSFKSEKGDPAATAAQRRDPYEVLGVGRNATDQEIKSAFRRMALKYHPDKNGDD
PVASDMFQEVTFSYNILSDPDKRRQYDTSGFEAIEADSQELELDLSSLNTVNTVFAALFS
KLGVPIKTTVSATVLEEALNGSVMVSQLQLGNSVHRKVEKQSAHFYSVDITEKEAKMGLV
CRVKSTDRSKFKLLYFELEENGGLSLALQEDSVKTGKVTSAGMYFLGFPVYRFEQNNLAA
AAKDPDSAFFKRLDSFQPCDINELKPGTHFFAVYGDNFFRSVNYTIEVVCGESFPAEKEK
LQSVEAKILTKRAELSKFETEYREVLAKFTEMTSRYTQEMQAIDNLLKERNEIHASYTNN
SPLKRSSSRSKAKSPSKFSKGEEENSQRKEKKVKDQPTGGCRSADEDSNEKKTKERFPKK
KWLNIPFKIDRRKPC
Download sequence
Identical sequences A0A0E0A7A9 B9FSF0
OGLUM06G09320.1 LOC_Os06g13060.1|PACid:21930357 LOC_Os06g13060.1|13106.m01438|protein XP_015641302.1.37577 39947.LOC_Os06g13060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]