SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g37620.1|13106.m03895|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g37620.1|13106.m03895|protein
Domain Number 1 Region: 435-709
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-71
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 727-804
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-24
Family U-box 0.0026
Further Details:      
 
Domain Number 3 Region: 41-188
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000393
Family Universal stress protein-like 0.015
Further Details:      
 
Weak hits

Sequence:  LOC_Os06g37620.1|13106.m03895|protein
Domain Number - Region: 322-403
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00235
Family FCH domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g37620.1|13106.m03895|protein
Sequence length 806
Comment protein kinase family protein, putative, expressed
Sequence
MASSSSSSSSSLASSSGGGDAASASASASAAAAAGAIVVAVAVRGDGRASRRAARWAAAN
LAAHGAGAGRVALVHVIPPVSFVPSPSGERVPVEKMDAETVEMYAEDRRARAQEEVFLPL
RRLFARTTVETVILEEPSVTAALVRYAADSGVRNLVVGSTSLNWFKRILRLRDVPSTVLK
AMPCSCNVFVVSRHRLTIKFANQARTSKSSACVRTQSISHKSFSRIQKNWLLDKQSLHDH
PEDGTPKSSGDTSYAGSHTCSSRSTSTNAGKSSGSHGRSLFGSLGRKTPGRDVNTDPDAI
GRLKEIPYVALSSIDEDLQSQPVDEVAKLRKELQDTLVMYDKACEDLVHAKKKIKVLSSE
CTEEAKKVQDALHREELLKQKVADEKTRHLEAVTEVEMAKTLFAQEAFSKHKAEIVADMV
IAEKTKVMDALLSTGKSCRRYSKREIQLATDNFSDAKKIGEGGYGNVYRCTLDHTEVAVK
VIQQDSSDKIDEFLREVEILSQLHHPNLVLLLGFCPEIGCLVYEYMENGSLEDQLINNKG
QQSLHWFLRIQIIFEVACGLAFLHATKPEPIVHRDLKPGNILLDKNYVSKIGDVGLAKLI
SDIVPEGLTEYRDTAVAGTLYYMDPEYQLTGTIRPKSDVYALGIIILQLLTGKRPHGLIL
SAEEAIKKDSISDVLDSSQIDWPIAEAEILAKLAVRCTALKCRDRPSLESEVLPEIESIL
SRITASPTLRSPNAAVPSHFICPILQEVMDDPYVAADGHTYEHRAIKAWLKKHKTSPVTK
QRLQYLSIIPNHSLRVAIQQWKSQSS
Download sequence
Identical sequences A0A0E0PZF5 Q5Z7K5
XP_015643342.1.37577 39947.LOC_Os06g37620.1 LOC_Os06g37620.1|PACid:21931136 LOC_Os06g37620.1|13106.m03895|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]