SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g03390.1|13107.m00279|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g03390.1|13107.m00279|protein
Domain Number 1 Region: 268-298
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000698
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g03390.1|13107.m00279|protein
Domain Number - Region: 9-77
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00146
Family FCH domain 0.038
Further Details:      
 
Domain Number - Region: 366-410
Classification Level Classification E-value
Superfamily Acid proteases 0.0137
Family Retroviral protease (retropepsin) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g03390.1|13107.m00279|protein
Sequence length 415
Comment retrotransposon protein, putative, unclassified
Sequence
MSGTSSDEPTLENLAHKLKGMENWYEELMRNSKSYKESTDKHLKTLSESLVKVVDQIEKM
NQSHKQLTENIQNMIIEHENIVRRIGLLEAAGEEGAGATAHRHQIYDDEDEEQSVADDVE
EDESVGNRRQRRVRDKDDPLSKVKFTMPSFDETYYQEMMIALSRCDLQETEDARISRFYG
SLNREIRDILEYKEYNTMNRLFHFACKAEREVQGRNKHRSSFAGATSTRQSTPRQATTAV
RSPTSTPSNAQEKSKNASVQTPAKSATSVASTGRTRDITCHKCHGIGHIARDCPNRRALF
VNDDGEYTSTSDCDDEYALAATDHAGGQDNDDIEEVHLHPESLDQYPSLIVKLALSAKEK
CEEQNQCHNLFQSKVLVKDHTVKMIIDSGSCNNLASEEMVKKLGLTTHPPPRIST
Download sequence
Identical sequences 39947.LOC_Os07g03390.1 LOC_Os07g03390.1|13107.m00279|protein LOC_Os07g03390.1|PACid:21898703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]