SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g04550.1|13107.m00395|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g04550.1|13107.m00395|protein
Domain Number 1 Region: 26-131
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-17
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g04550.1|13107.m00395|protein
Domain Number - Region: 205-262
Classification Level Classification E-value
Superfamily Peptide deformylase 0.0589
Family Peptide deformylase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g04550.1|13107.m00395|protein
Sequence length 484
Comment pleckstrin homology domain-containing protein, putative, expressed
Sequence
MASSGSSTVVGEMESSLERVRRQLSSTSSRHLLQGPLLKRSDTLRKWNERWVILDPATGK
MEYKIRRSDAAVRGIIVFDSTSTVTLSPMNFHGLPKYDGCCFYIGTPQKKEYFLCAETPS
AARAWVSTLHASQLVLQAHKEAVNSLGGNGPTKLGKVATVVAVANATAIEASKEVEAAMK
VSLRAALGSTTNKLSKGQLDDLTIMMETLRVKDDELHQLLQDIRARDATIREITDKLQET
AEAAETAASAAHSIDEQRRFLSSELERLKQDQEKQIEFSLLRLRESEEKAKLLSEEREHL
LKERDSALQEAQMWRSELGKARGNAVILEAAVVRAEEKARVSAADADMRINDAASRLDSA
TKEKEELVALVDALQLQIRSQDTSTKQVCEERSELCSTSSKHVDMEDDNVDKACLSDTDP
IPITENIVDLDDDGVDIPTIGVTEWNNPHSSEVSDVREVTTEPEDNSLDIPVDSQPVSEN
AFHG
Download sequence
Identical sequences B8B743 Q6ZE09
LOC_Os07g04550.1|13107.m00395|protein 39947.LOC_Os07g04550.1 LOC_Os07g04550.1|PACid:21902277 XP_015646512.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]