SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g11070.1|13107.m01140|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os07g11070.1|13107.m01140|protein
Domain Number - Region: 596-730
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0126
Family Arfaptin, Rac-binding fragment 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g11070.1|13107.m01140|protein
Sequence length 737
Comment DUF630/DUF632 domains containing protein, putative, expressed
Sequence
MGCAQSNEDGEGPVARCRERKHLLRDAVAARHALAGAHAGHAAALKNVGAALSDYASGEG
EAHAGGALRSGSADSSAAAAALVTASSDGKPVLAILPPPPPELPPPPPPPPLPPHGDVEA
APLARSMSAPDLHLQQPIKKKPSGEAPIMEEEDDEGGDGGDAGGRRGDDDAELKPPPPLP
SQRPPPSRSPPPLPPENDHKVDTPGGFISSLFDSMPPPTLDTAAAEPSSSASAERREPPP
PAPDEHQPSAAAREVAEGKRPAAAEAATTRRAMTQKAARKGKAKAVMLVAPPQPQPAKLG
VGDILRALDEHFLKASQSAHEVSKLLEAARMHYHSNFAETRGFVDHSARVMQVITWNRSF
KGIPQPENVRNEMDDDEWETHATTLDKLLAWEKKLYHEVKDFEVIRREYQQKLAVLNKKK
QRGVTSSSLEKTKSVVSHLHTKYVVDLQTMESTVAEINRLRDQQLYPKLLELVKGMWHMW
DAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHEWHTQFDKFMTYQKQ
YVGSLYTWIKLNVIPIDTNLKPNSSQPHETTPPIKRVLHAWHEILGKLPDEAAKKAINTF
AEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQTAGILPEDRNPDGAR
PDPMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNLPELFRVVSDFSLQSAG
MFKGVWSIAHTNDQLDE
Download sequence
Identical sequences Q8H4U8
LOC_Os07g11070.1|PACid:21901261 XP_015644794.1.37577 39947.LOC_Os07g11070.1 LOC_Os07g11070.1|13107.m01140|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]