SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g19090.1|13107.m01997|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g19090.1|13107.m01997|protein
Domain Number 1 Region: 203-236
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000872
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g19090.1|13107.m01997|protein
Domain Number - Region: 240-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000732
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 
Domain Number - Region: 63-118
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g19090.1|13107.m01997|protein
Sequence length 267
Comment zinc knuckle domain containing protein
Sequence
MVIKLMEAIEKQQACTIKKNEEIMSLTEEHKKLKDFHSSLTMRYEKLENEFACATNSIAC
VASLEKQNQELKSQLDEITNKYVDLQERHDELLCSHENLVDSHAMLEVSHEVIIATVKSY
EPHVQVDLTCTNPCCAQANISPSTIYDLDCVGKREKQIDHGLVCIAQPSQDNCEGMVKNL
EEGSTVACTRIHQRDSKSINAYTKGRNQKMIKSSITCFKCKKVGHHARDCPWKKGNKLSK
KKDIPHIKCFKCTEVGHFASRSPCVTS
Download sequence
Identical sequences 39947.LOC_Os07g19090.1 LOC_Os07g19090.1|13107.m01997|protein LOC_Os07g19090.1|PACid:21898191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]