SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g30840.1|13107.m03112|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os07g30840.1|13107.m03112|protein
Domain Number - Region: 185-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0356
Family IMD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g30840.1|13107.m03112|protein
Sequence length 262
Comment proteasome subunit, putative, expressed
Sequence
MAMDAERRQAELIEQFSAQAAALSSSAPQLAALVLEATSHPALFAFSELLSLPALSKLTG
TQYASSLDVLRLFAYGTLKDYKSNSGNLPALLPDQVRKLKQLSVLTLAESTKVLPYDQLM
QELDVSNVRELEDFLINECMYSGIVRGKLDQLRRCFEVQFATGRDLTPDQLNNMIDTLSD
WLGTSDNLLHQIQEKIKWADTMSEVNKKHQKEFEDKVEEAKKSIKQADIDLRGHDDFLSE
PGGIMDFEEDRIRPKRRRQPMA
Download sequence
Identical sequences LOC_Os07g30840.1|PACid:21901060 XP_015644831.1.37577 39947.LOC_Os07g30840.1 LOC_Os07g30840.1|13107.m03112|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]