SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g46450.1|13107.m04900|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g46450.1|13107.m04900|protein
Domain Number 1 Region: 196-389
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.47e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00066
Further Details:      
 
Domain Number 2 Region: 29-147
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-18
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g46450.1|13107.m04900|protein
Domain Number - Region: 688-748
Classification Level Classification E-value
Superfamily AF1862-like 0.0889
Family Cas Cmr5-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g46450.1|13107.m04900|protein
Sequence length 871
Comment pleckstrin homology domain-containing protein, putative, expressed
Sequence
MAAATAPVAGAAERQQQQQQQQRGGAASASGNAVFKSGPLFISSKGIGWKSWKKRWFILT
RTSLVFFKSDPNTLPQRGGEVNVTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTL
KAETSEDLFEWKTALEEALAQAPNAALVMGHNGIFRNDTTDPYEGAVPNWREKRPIKSLV
VGRPILLALEDIDGSPSFLEKALRFLERHGIKVEGILRQAADVEEVDKRMQEYEQGRTEF
AQDEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAFRLESKESRINSMRAAISETFPEP
NRRLLQRILRMMHTVASHTAENRMTASAVAACMAPLLLRPLLAGECEMEDDLDMNGDSSA
QLIAAANAANSAQGIVTTLLEEYEGIFYDEHLRCSLSPDSQIEDSGSEESTDDETVDIKD
SGFHDAENDADQELDDSERILSGKLSETSACTAGDLYDYKVADDDSDGEPSTEDKALETK
VDVNDAQHSHLAENVSVNVQRSPNEKDPPNMVSSQDSPLSMGDILSSLDAGISLPGPGPE
YSVDRQSIKSNGTQMHVKRSNFWGRNNGRKSQQSELADSSGEEELAIQRLEITKNDLQIR
IAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMSSAH
ISSSRSMDSKTKAELEEIALAEADVARLKQKVAELHLQLNQQRQHQYGSLADANDRYQHL
PNHLPQNFVQSGFDMNLAFCNQEKKQRNEGPAGASHWRSIKQHVLPHGSSRPFSRKHSMD
ASSSDSREASTSMPADGNSMSVNIPKATEGVEYGRQAPVASSTLVELTTRLDFFKERRSQ
LMEQLHSLDLGNGSANHGFPYKSSSPWNSPR
Download sequence
Identical sequences A0A0E0QC72 Q0D3Z0
XP_015648039.1.37577 39947.LOC_Os07g46450.1 LOC_Os07g46450.1|13107.m04900|protein LOC_Os07g46450.1|PACid:21898928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]