SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g25060.1|13108.m02571|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g25060.1|13108.m02571|protein
Domain Number 1 Region: 126-172
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000000432
Family BSD domain 0.0028
Further Details:      
 
Domain Number 2 Region: 203-255
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000144
Family BSD domain 0.0088
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g25060.1|13108.m02571|protein
Domain Number - Region: 19-102
Classification Level Classification E-value
Superfamily PH domain-like 0.00234
Family TFIIH domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g25060.1|13108.m02571|protein
Sequence length 604
Comment BSD domain-containing protein, putative, expressed
Sequence
MGSMTIGAKYKTTLKDPGTTGVLRMNEDKFTFTPHDPRSAMKLNVDFRSIKGHKFNKVDG
SKPAPPLLNLSKDSDKGGGYMFEFDNVTNRDLSRDFVAKVLGKQQGTIPPKPNVPPENSV
TSTGEEQLSAAEMQRRMKLLQEDSELQKLHMKFVLGNILQESEFWATRKNLLEDEANKGS
KQRPGFKSAMLADVRPSADGRTNKVTFSLTTEIIHQIFAEKPAVHRAFLDFVPKKMSEKD
FWTKYFRAEYLLRTKNTVAATAEAAEDEELAIFLKNDDILAKEARLKIKRVDPTLDMEAD
AGDDYIHLPDHGIIRDGSKETIDNDGELARRTLSQDLNRHAAVVLEGRSSDVELTDTKTV
AEAIARSKKEPPSSSISDDTNHERLVKVARMTEIEDLQAPRSLPYAPLCIKDPREYFDSQ
QANALRSLGGNNDGRHARNCRLSTDDAFDHLLGQISSIKVNGLNYPVIQSDVALKVLNEL
NEGISRSRRLNLKNPQDSLLGQIPRRTRDELMDHWAAIQELLQHFWSSYPITTSVLYNKV
QRIKDAMTQIYQKLQDIKESAQPDVRHEISQLVKPMTQALDAAFNHDLEQQQKSSKSGNK
PNGF
Download sequence
Identical sequences I1QHV3 Q6ZC85
LOC_Os08g25060.1|13108.m02571|protein LOC_Os08g25060.1|PACid:21890107 XP_015650975.1.37577 ORGLA08G0100400.1 39947.LOC_Os08g25060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]