SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g34060.1|13108.m03559|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g34060.1|13108.m03559|protein
Domain Number 1 Region: 230-398
Classification Level Classification E-value
Superfamily Bet v1-like 7.97e-29
Family STAR domain 0.024
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g34060.1|13108.m03559|protein
Domain Number - Region: 50-156
Classification Level Classification E-value
Superfamily PH domain-like 0.0167
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g34060.1|13108.m03559|protein
Sequence length 763
Comment DUF1336 domain containing protein, expressed
Sequence
MATITLKPPATAAAAGGEVSEVELSEAGSPDVGSQSSGSGGSGRSTAGSSGWVYHLGVNS
IGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYV
LRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQADYDLMTRGVSWNRSQNENELNLD
GHRPRVRRYAQGLGKLVRIGKGPEKLLRQSSNLQSHEIINTNFGGDSGDAFEAHEWRYVR
TFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELV
ETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGY
ERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQ
VAGLREYFAANPALTSDLPSTVVKPKQSDSLIIQSELEDSELNDEFYDALARGESFEDED
SDDDDDMIPKAGKVKFKNISWAIAGLAMKPTKASVEKSELVTNSTPVTIDSNHFHGTLRR
AKSENDPNSWSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHP
KSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDAR
FKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVL
GYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRANPDSAVPI
Download sequence
Identical sequences Q6Z9J1
LOC_Os08g34060.1|PACid:21886775 LOC_Os08g34060.2|PACid:21886776 LOC_Os08g34060.1|13108.m03559|protein LOC_Os08g34060.2|13108.m03561|protein XP_015650076.1.37577 39947.LOC_Os08g34060.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]