SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g44260.1|13108.m04799|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g44260.1|13108.m04799|protein
Domain Number 1 Region: 192-363,390-476,519-638
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-116
Family Myotubularin-like phosphatases 0.000000139
Further Details:      
 
Domain Number 2 Region: 32-154
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-17
Family GRAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g44260.1|13108.m04799|protein
Sequence length 827
Comment inositol or phosphatidylinositol phosphatase/ phosphoric monoester hydrolase, putative, expressed
Sequence
MDGSGSWDAIDWNQIKEPRPPRSSSRGMEDFLLEDEEVYAQGHGVVLLNTDEAGILSVTN
FRLLFVSQATKGVIELGTIPLTAIEKINDDVKLQPLPRQHDKKQPRELLQVIGKDMRVIV
FDFLPKTKQKNEVFDALRRYSKPTHLWDLYAFSCDPSTVYQKSDPKMRLLKEYHRLFRKW
FPHSGSEFEKDLRNEWWRVSKVNSTYSLCSTYPSALIVPRSISDEDLLQASSFRSGRRLP
VISWCDPGSGAVLARSSQPLVGLMMNFRNNTDEKLVSALCTQIIDATGSLRKLYIVDARP
RANALANGAKGGGSESASNYPRSEVLFLGIQNIHTMRDSLFRLRDYVDTHGSVSSNGTSS
AVSLVGDRRNRGSTWGGGNLNSMTQFSSMLGEWLNHIQSIMVGASWIAAQIVQESASVLV
HCSDGWDRTTQLVALACLLLDPYYRTFNGFQALVEKDWLAFGHPFAERMGVPTITDNNSG
SQFELLRQPSLGTLSNSPNRGALGSSVSTSNTTSGQSQTSNNSSPILLQWLDCISQLLRL
YPSAFEFSSKFLVDFMDCVLSCRFGNFLCNSEREREQSGAVSSCHCMWTYLADLRASGGS
FHKHRNPFYDPLKHNGPLVPPAAALAPTLWPQFYLRWTCPIESQGGDLESQWHAMNKKYT
EAMKAKDTAESRVKDIKTKMESMQLELQREKRASSSALAMAQRAQRESVAIRKAVRSLGC
TVNFGTNESQVEKTEGLTYSFRRDTDFESQHEKSSDFSVSITAIEDSLVSETPSNHICES
LCPFRTREGCRWPDAACAQLGSQFVGLKANFDAFDRLSVQDSYFGSE
Download sequence
Identical sequences I1QKC2
ORGLA08G0187300.1 XP_015650270.1.37577 LOC_Os08g44260.1|13108.m04799|protein 39947.LOC_Os08g44260.1 LOC_Os08g44260.1|PACid:21887702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]