SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g15770.1|13109.m01496|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g15770.1|13109.m01496|protein
Domain Number 1 Region: 299-444
Classification Level Classification E-value
Superfamily ARM repeat 7.48e-29
Family MIF4G domain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 10-101
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 6.28e-22
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.0037
Further Details:      
 
Domain Number 3 Region: 98-133
Classification Level Classification E-value
Superfamily Zinc-binding domain of translation initiation factor 2 beta 0.000000536
Family Zinc-binding domain of translation initiation factor 2 beta 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g15770.1|13109.m01496|protein
Sequence length 450
Comment CPuORF13 - conserved peptide uORF-containing transcript, expressed
Sequence
MALQNIGASNRDDAFYRYKMPRMITKIEGRGNGIKTNIVNMVDIAKALARPASYTTKYFG
CELGAQSKFDEKTGISLVNGAHDTAKLAGLLENFIKKYVQCYGCGNPETEVLISKTQMIT
LKCAACGFVSDVDMRDKLTTFILKNPPEQKKGAGKDKKAMRRAEKERLKEGEAADEEMKK
LKKEAKKKGASKESTSSKSGAGKKKAAAGSDEDHSNSPTRSHDGDNVAADEDDDDDVQWQ
TDTSLEAAKQRMQEQLSAATAEMVMLSTEEPEKKKKHEASHKEGASNGSTKHVVEEAKSS
PYDDLVKEMKDNLSKGANAVQLKGLMTSSALPPQDAMNALFDALFGGLGKGFAKEVVKKK
KFLAAAVPDEASQMVLLQALVAFGAKSSPEAVKEVPIVLKALYDGDVLDEEVITQWYNES
VAGGKESQVVKNAKPFVEWLQSADSESEEE
Download sequence
Identical sequences A0A0E0QPV2 A2YZW8 Q6K2P9
LOC_Os09g15770.1|13109.m01496|protein LOC_Os09g15775.1|13109.m18570|protein OsIBCD044443 39946.BGIOSIBCE029489 39947.LOC_Os09g15770.1 39947.LOC_Os09g15775.1 XP_015611915.1.37577 LOC_Os09g15770.1|PACid:21927481 LOC_Os09g15775.1|PACid:21926646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]