SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g33510.2|13109.m07549|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g33510.2|13109.m07549|protein
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.38e-22
Family BAR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g33510.2|13109.m07549|protein
Sequence length 627
Comment hydroxyproline-rich glycoprotein family protein, putative, expressed
Sequence
MKSSLRKLRGFALQRHEQRVDRRGGHSPAAAAAANELLAASQDMADMRSCYDNLLSVAAA
IANSAYEFSEALQEMGTCLLKRVTPNKDGINDKVLLLLGKAQFELRKLVDSYRVHVLNTI
TTPSQSLLNELQTVEEMKHQCDEKRELFEFLLNAQKEKGRSKNAKSDIGASEQLKQAQDD
YQEEATLFLFRLKSLKQGQFRSLFTQAARHHAAQLNLFRKGLKSLEAVEPHVRLAAEQQH
IDHQFSALDEEDYSVDEENEDDYNDSHEDLSFDYGENKEGTEAGHASRSPTEELLDRSKA
EYSSFPGERQRSGSQSAPLFPEKKLEAAERIKELRRSATRKLYTYVLPTPNDVRDTSQTV
TANPTSGSPLGNKGAFYSSPLQPSTNVGDLRDNKLPSPTRLSNAHSVLKESNTNTTDTRT
MLVLPLGDLSLPGYHDSKASDNKKVKRGSFSGPIVPRSRSTENIDVVSVPPRHSSSHQPS
IHVRVSPNTSPPLLSSPKIKELHELPRPPANASKHTTFPSLVAHSAPLVPNSAPLAPRGQ
DHFRPRQTPPSAPQTASPLPTPPGPISRSFSIPSRGMRTSGISDGKETEDLQDKGPARMS
LSSLPSAQTSLEDHRPLSGATESVSKT
Download sequence
Identical sequences A0A0E0QTK0 Q0J0H3
39947.LOC_Os09g33510.2 LOC_Os09g33510.1|13109.m03331|protein LOC_Os09g33510.2|13109.m07549|protein LOC_Os09g33510.1|PACid:21925480 LOC_Os09g33510.2|PACid:21925481 XP_015612244.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]