SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g33800.2|13109.m03371|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g33800.2|13109.m03371|protein
Domain Number 1 Region: 13-98
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000184
Family GRAM domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g33800.2|13109.m03371|protein
Sequence length 174
Comment arabinogalactan protein, putative, expressed
Sequence
MLVLRAPGGHAKTKGTIYLSNIRMVFVASKPVGNFFAFDMPLLYVHGEKFNQPIFHCNNI
SGFVEPVVPENQNRALYSTHTFKILFKEGGCGTFVPLFLNLVASVRRYNQFEAQSAASMA
PRVDPLQAVQTPVDDMMRHAYVDPNDPTKIFLQQPAPESQLRRRNYHGRADNAY
Download sequence
Identical sequences B7ECT5
LOC_Os09g33800.2|PACid:21926749 LOC_Os09g33800.2|13109.m03371|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]