SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g37040.1|13109.m03667|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os09g37040.1|13109.m03667|protein
Domain Number - Region: 479-605,633-694
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00293
Family BAR domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g37040.1|13109.m03667|protein
Sequence length 722
Comment DUF630/DUF632 domains containing protein, putative, expressed
Sequence
MGNCAASRLAGGGGGGGCGDPVAVCRDRKRLIKAAADRRFALAGAHAAYAAALRSVADAV
DVFVARHTAPAPILITLPTPTGSPPASPAPAPAPAALASVAQGGEEEEGKAEVDDGGGAR
TPDLGCPYYYAPPETATATPPPPPPAASAVGGWDFFNPFYGTEEVAAAAISDEEMRAVRE
REGIPELEEAEEEDDEGAKSAAAANAKTPKAAETSLGVTKQEEAKDVCEVASNNGGRGGG
LEVAVSQPGRELLAALKEIEELFARAAEAGKEVTAMLEAASRVPELKENSSKIIHAITWH
RSPSSVSSSYRSELGASSNSLSWTDKSETKSDIFDDYGGMKSGSHSQTLGRLYAWEKKLY
EEVKAIDQIRQTYEKKCVQLRNQDAKGSELRCAEKTRTTVRDLYTRIWVSLRAAESISDR
IQKLRDEELQPQLVELLQGLTRTWKIMVDSHETQRQIMFEVNSFTCPAYGKFCNDAQRHA
TLKLEAELRNWRSCFMIYVSAQKAYIEALDGWLSKFILTDTIRYSRGISSIAPDRSSAPP
LVVICHDWYTTLSKFQNKRVAFTMRNFIRSVRVLWLKQGEEQQQKRKVDSLAKEMDKKIS
AYKRAENKVIETKLLEHRPEQDAKQRMEHLSEKKEMLNVLRKRVEAEKAKHHACMRDTHD
VTLNGFKIGLASIFESLTEFSKDSVKLYEDLLTHAEPKGSEDATEKRPCVEGPYSQISVD
AT
Download sequence
Identical sequences Q7X997
XP_015610617.1.37577 LOC_Os09g37040.1|PACid:21926172 39947.LOC_Os09g37040.1 LOC_Os09g37040.1|13109.m03667|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]