SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g39620.1|13109.m03977|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g39620.1|13109.m03977|protein
Domain Number 1 Region: 491-766
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-71
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 781-856
Classification Level Classification E-value
Superfamily RING/U-box 5.21e-23
Family U-box 0.0017
Further Details:      
 
Domain Number 3 Region: 80-202
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000151
Family Universal stress protein-like 0.045
Further Details:      
 
Weak hits

Sequence:  LOC_Os09g39620.1|13109.m03977|protein
Domain Number - Region: 346-475
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000837
Family FCH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g39620.1|13109.m03977|protein
Sequence length 858
Comment protein kinase family protein, putative, expressed
Sequence
MAVASARSSLPSSSSSPLPPLSPQPVVPAGVERMLVRAGGGTRSLREIDEEEDDDDDDGG
KTYVSVGKDLKDGKANIQWAARKLQPQQGDVNKLLVLLHVHQPADRIMSGLCKVPAKQLE
EKELRAYRKIEKDDMNKLLEQYLSYCRAFPKVQAEKLVIEKNSVANGIVELIDQHHITKL
VMGTSSFSVKRQVPKSKVAAIVHQQAKPYCQILYICKEALACTREASQFADKGDSPRSSS
GSSLSDKSEFPPRSVSLPSWYSGFLGSPDQQSLPRRSNSISHPFPFSRQLENGVENISPI
RPNSVDVAPKGCSPNSSHQSKGSSPTLTDLDTVDGLSVPVSSSSSEEHQHFMVEANMQNE
MFEQWQQVRNELERSRKEASEGRQKAEKELFEASKMFRARENSLCKEKIAVEERLTREKV
SLEKEHLQIYNELQKANEQIMELERKLMHANSLMEELQTVQGELQRQKDNAVKEAEKMSQ
INCNNVSCSTSAVALTEFTYTEIKEATNDFDESKMIGHGGCGSVYKGFLRHTTVAIKKFN
REGITGEKEFDDEVEILGRMRHPNLVTLIGVCREAKALVYEFLPNGSLEDRLQCKHQTDP
LPWRMRIKIAADICTALIFLHSNKPKGIAHGDLKPDNILLGDNFVGKLGDFGISRSLNLT
NTTITPYHQTNQIKGTLGYMDPGYIASGELTAQYDVYSFGVVLLRLLTGKSPLGLPSEVE
AALNNEMLQQVVDASAGEWPPEYSKKLAILALRCCRYDRKERPDLAKEAWGVLQAMVNYP
DNKCKIPSFFICPMTQEIMKDPHIAADGFTYEGEAIKDWLQRGHKTSPMTYLSFTHYELI
PNNALRFAIQEWQMKQQL
Download sequence
Identical sequences Q0IZH1
39947.LOC_Os09g39620.1 LOC_Os09g39620.1|PACid:21926623 XP_015651175.1.37577 LOC_Os09g39620.1|13109.m03977|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]