SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g25320.2|13110.m02133|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g25320.2|13110.m02133|protein
Domain Number 1 Region: 4-95,174-404
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.47e-82
Family IF2B-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g25320.2|13110.m02133|protein
Sequence length 414
Comment initiation factor 2 subunit family domain containing protein, expressed
Sequence
MPDVQPLVSEFVLKLKRRKVEGSHAVARQTAELLRSVVSQHRMGSTNQAAALADAVRGVG
EQLIAANPIELAVGNIVRRVLHIIKEEDISSTAVGIEGLSVTAESDDEYDSGNDDHPTLS
AAVLAAHARNALRAPSLQTLLEDIPVSTALSRSASSAGDSDGKSGDKSSKSRKLKHDVIA
AIGDLIDEIDTCYDQISEQAVEHIHQNEVILTLGRSRTVKEFLYAAKEKKRSFRVFVAEG
APRYKGHVLAKELVEKGVQTTVITDSAVFAMISRVNMVIVGAHAIMANGGVIAPVGMNMV
ALAAQRHAVPFVVVAGSHKLCPLYPHNPEVLLNELKSPSDLLDFGEFSSCMNFSTQDGTP
LLNVVNPTFDYVPPKLVSLFITDTGGHSPSYMYRLIAEYYSADDLVVRRKSTSS
Download sequence
Identical sequences A0A0D3HD92 A0A0E0BA13 A0A0E0QYM0 I1QU52 Q7XEY8
LOC_Os10g25320.2|PACid:21884177 OBART10G08740.1 OGLUM10G08500.1 ORGLA10G0073500.1 XP_015614908.1.37577 LOC_Os10g25320.2|13110.m02133|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]