SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g27210.1|13110.m02330|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g27210.1|13110.m02330|protein
Domain Number 1 Region: 49-86
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000333
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g27210.1|13110.m02330|protein
Sequence length 117
Comment hypothetical protein
Sequence
MDESIPWDYDGIKCASCMQGMEGSTSKHDSLVQKHVDFGILENNIQDPTATPMYLPMEFL
KTITCDFSKEQELGRGGYGVVYKGAFGSKASRGLAWPGKDSRLESEKNPSPWGRASP
Download sequence
Identical sequences Q7XER4
LOC_Os10g27070.1|PACid:21886079 LOC_Os10g27210.1|PACid:21883902 39947.LOC_Os10g27070.1 39947.LOC_Os10g27210.1 LOC_Os10g27070.1|13110.m02316|protein LOC_Os10g27210.1|13110.m02330|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]