SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g27480.1|13110.m02362|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os10g27480.1|13110.m02362|protein
Domain Number - Region: 321-420
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0565
Family BAR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g27480.1|13110.m02362|protein
Sequence length 598
Comment expressed protein
Sequence
MAAKNHARSQDFWRRFWSMLSYACSELCLIILLHVAAGASYLATRLARIHKLKMPCILCT
RMDHALHGKPWFSSDLVCAAHRSEISSLAYCSSHNNLAQCDDLCKRCTVATNDVVDTRRS
KSRQLCSCCSEPFTKARNAHRISETASVSGEINREQIPADHSKDKAFVVGIEEVNESDSS
PRTYEQSTKNNGASGNAGTAKLAPSGSTVPMRVFVDRNSSVKNGFISRANLSSPRPSQII
SAKDSNSTTQQEVKAFLSQMSTVRGIDSSWSDGAPSPGINAQTDESNANGRRPSLERNYS
VIEPSDANLADEVEGESSPENLKRLLELNKKSMSALYKELEEERSASAIAASQAMAMINK
LHEEKAAMQMEALQYLRMMEEQADHDHEAIQNLHDLLTEREKELLDMDAELENFRRLVQN
EQFNGGKHDIAGIMNETDMPFEVLNDLGYTKNTMSGFEDEMAYILESISRLEDKLCVSTN
RLASDDAKINQEGLIGGADFGSSPTHGESTSDQQDDGNKSVQNHKDNCSCSHPEDGKTSD
ANLKDEVSLLHTRLQALEADQEFLKHVLNSLRCSPDGLQCVQAIASHLLELRRIATQR
Download sequence
Identical sequences Q7XEN2
39947.LOC_Os10g27480.1 LOC_Os10g27480.1|13110.m02362|protein XP_015614630.1.37577 LOC_Os10g27480.1|PACid:21885838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]