SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g33630.2|13110.m02963|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g33630.2|13110.m02963|protein
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-49
Family Necap1 N-terminal domain-like 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g33630.2|13110.m02963|protein
Sequence length 287
Comment adaptin ear-binding coat-associated protein 2, putative, expressed
Sequence
MAGVGVEEEEAFEHTLLVVREVSVYKIPPRTTSGGYKCGEWLQSDRIWSGRLRVVSCGDR
CEIRLEDPASGDLFAACFVLPGQREAAVETVLDSSRYFVLRIEDGRGKHAFVGLGFGERN
EAFDFNVALSDHEKYVKREHEKEAADGGAGGGEENDDGQIDIHPAVNRRLKEGETIRINV
KNKPSTGSGMLSSAGLSGGASAKPKASMLLAPPPGSAGKLRSPLPPPPNDPAAARMNSGS
NAGIRAPKEPAKRNSDAFSDLSAMKQNLPSSTESAQTKSTGAGWAAF
Download sequence
Identical sequences A0A0D3HEP2 A0A0E0ITY4 A0A0E0R0C3 A2Z8I3 Q9AUZ3
OsIBCD030953 XP_015614217.1.37577 OBART10G13110.1 39946.BGIOSIBCE032460 39947.LOC_Os10g33630.1 LOC_Os10g33630.1|13110.m02962|protein LOC_Os10g33630.2|13110.m02963|protein LOC_Os10g33630.1|PACid:21884658 LOC_Os10g33630.2|PACid:21884659 ONIVA10G14400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]