SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g36870.1|13110.m03347|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g36870.1|13110.m03347|protein
Domain Number 1 Region: 45-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.19e-24
Family Arfaptin, Rac-binding fragment 0.063
Further Details:      
 
Domain Number 2 Region: 263-359
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g36870.1|13110.m03347|protein
Sequence length 370
Comment src homology-3 domain protein 3, putative, expressed
Sequence
MEAIRKQASKLREQVARQQQAVMKQFGGGYGADGAFADEAEAQQHSKLEKLYISTRAAKH
FQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGAENTCTSGSTLSKAALCFAKARSLME
KERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKLRE
TSGNGDMISRLEAAESKLQELKSNMGVLGKEAVASMTAVEAQQQRLTLQRLIAMVESERS
YHQRVLQILDQLEREMVSERQRIEGAPPPAVESSMPPPPSYEEINGVFMRNPTVAELVET
VEFFLAEAIQSYRAESETELNLAAGDYIVVRKVSNNGWAEGECRGKAGWFPYDYIEKRDR
VLASKVAQVF
Download sequence
Identical sequences A0A0D3HFK1 A0A0E0BCM1 A0A0E0H502 A0A0E0M9P0 A0A0E0R1B8 B8BHV1 Q337C1
LOC_Os10g36870.1|13110.m03347|protein OGLUM10G15420.1 XP_015612895.1.37577 LOC_Os10g36870.1|PACid:21884536 OPUNC10G14070.1 OsIBCD031185 OBART10G15530.1 ONIVA04G21790.1 39946.BGIOSIBCE032741 39947.LOC_Os10g36870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]