SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g40590.1|13110.m03762|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g40590.1|13110.m03762|protein
Domain Number 1 Region: 356-733
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.32e-114
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 48-86,116-172
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g40590.1|13110.m03762|protein
Sequence length 742
Comment oxysterol-binding protein, putative, expressed
Sequence
MRAREMHPLCCLVSDCALGGGGGGGGGEGGGGDCSPTKAAVGGEEEVVAVAGVLYKWTNI
GKGWRPRWFAIRGGVLAYSKIRRRVAAEPPPEAAAAAAANGVRLIGVPRGGVGDQPIGFV
PLKISSFSESKSDDKRFYIITPTKTLQLRTGSAKDRVAWIEALVSARSEYSLNGGVPCDQ
NEGSFSTEKLRNRLHAEGVGEATIKDCEQIIHSEFSQYHTQMKQRCEDYLNFIGSLPREL
EVVNSGDASAIEKPQSELFKHDCSSSGKCSEYSNTESSDDAGKQEVGQLSDEDEFHFYDT
RQSFSDTAASPDLKMRCSNSGSGAHKFGELLAIDKTNEYLLSSSKRRSELPVPIEKEKGV
SLWSMIKDNVGKDLTRVCLPVYFNEPLSSLQKCFEDLEYSNLLDRAYEYGSRGNGLMRIL
YVAAFAVSGYASTDSRPCKPFNPLLGETYEADYPEKGIRFFSEKVSHHPMVMACHCEGKG
WKFWGDSNLKSKFWGQSIQLDPSGVLTLQFDDGETFQWSKVTTTINNLIIGRVYCHHHGT
MNISGNRQYSCKLTFKEQSFLDRNPRQVQGLVTDANGTKVAFLMGKWDESMSCIIGDDAS
KVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTPGLKEKLPPTDSRLRPDQ
RHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTEDGTFRYVGGYWEAREQR
KWVGCNDIFGNNVSTLCTSASI
Download sequence
Identical sequences Q9AV10
LOC_Os10g40590.1|PACid:21884585 LOC_Os10g40590.1|13110.m03762|protein XP_015614786.1.37577 39947.LOC_Os10g40590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]