SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g41060.1|13110.m03820|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g41060.1|13110.m03820|protein
Domain Number 1 Region: 256-364
Classification Level Classification E-value
Superfamily PH domain-like 0.00000366
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g41060.1|13110.m03820|protein
Sequence length 379
Comment expressed protein
Sequence
MAMERAWKPREIADTFGIEMDEEEAAAAAIPPPQTPLEPMEYLSRSWSVSASEISKILFN
GSKKSFAAKRLPEMTIPENSVVAASIVPSHLQHIDTRRNSISSHHLPIGRWFQHKEASRV
KQSSKEKLRAEKAHVHAMVSVARVAAAVAAVTAATTSSDIQTSKMAAAMVSATELLASHC
VEIAQHAGARHEQVACAIQSAVGVRSSGDLMTLTAAAATALRGAATMKQRVQREMRSNAS
VLPYEKGHSWSPDIWCKEGELLKRTRKGDLHKTRVSIYINKRSQVILKLKSKHIGGALSK
KNKSVVFGVYNELPTWVEAGKHFTEERCCFGLSTAQGLVEFECENSTSKQRWVDDVKNLL
RQVAAEEQVENKLGSVKLS
Download sequence
Identical sequences A0A0D3HGL1 A0A0E0BDQ3 A0A0E0IWG3 A0A0E0R2F5 Q7XC71
LOC_Os10g41060.1|13110.m03820|protein LOC_Os10g41060.1|PACid:21883987 OGLUM10G18490.1 ONIVA10G20940.2 XP_015614436.1.37577 OBART10G18460.1 39947.LOC_Os10g41060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]