SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g05650.1|13111.m00550|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g05650.1|13111.m00550|protein
Domain Number 1 Region: 38-156
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-47
Family Dcp1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g05650.1|13111.m00550|protein
Sequence length 380
Comment mRNA-decapping enzyme, putative, expressed
Sequence
MPPPPPPQPQPTTTATTSANGGKVTPNLTMDAEGTRLLNLTVLQRLDPAVEDILITAAHV
TLYDFNIDLNQWSRKDVEGSLFVVKRNTQPRFQFIVMNRRNTDNLVEDLLSDFEYELQPP
YLLYRNAAQEVNGIWFYNQHDCEAVASLFGRILNAYAKVPPKPKVPSTKSEFEELEAVPT
SAAIDGPLEPSPATTTIVSDAPDESLVNYFSSAASIGSVSNAPMAGRAHPSSESVATPHV
PLIIPSATPTHQIPPPLVGSSAPPLPLHDTNVHTARSANLVTPAFFTPPSSSSTSMVPPA
SSMMPTAPPLHPTSASAQRATYGTPLLQPFPPPTPPPSLTPSYNEGPIISRDKVKEALLR
LVQNDQFIDLVYRELQNAHM
Download sequence
Identical sequences I1QXT8 Q53QH1
ORGLA11G0033000.1 ORGLA12G0180700.1 LOC_Os11g05650.1|13111.m00550|protein 39947.LOC_Os11g05650.1 XP_015617840.1.37577 LOC_Os11g05650.1|PACid:21945978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]