SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g40940.1|13111.m04060|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os11g40940.1|13111.m04060|protein
Domain Number - Region: 450-507
Classification Level Classification E-value
Superfamily Acid proteases 0.000281
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 
Domain Number - Region: 358-384
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000549
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 
Domain Number - Region: 24-73
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0286
Family FCH domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g40940.1|13111.m04060|protein
Sequence length 725
Comment retrotransposon protein, putative, unclassified
Sequence
MSGTSSDEPTLENLAHKLKGMENWYEELMRNSKSYKESTDKHLKTLSESLVKVVDQIEKM
NQSHKQLTENIQNMNIGHENIVRRIGLLEAAGEEGAGATAHRHQRYDNEDEEQSVADDEE
EDESVRNRRQRRVRDKDDPLSKFEPSVYLDWELAVEQKFSCYDFPDNKKVKAASSEFTSF
ASLWWNDICGRGLRPRTWDDMKRTMRSRFVPFYYARDILNKLQLLRQGPNSVETYYQEMM
ITLSRCDLQETEDARISMFYGGLKREIRDILEYKEYNTMNRLFHFACKAEREVQGRNKHR
SSFAGATSTRQSTPRQSTTAVRPASSTPPTSTPSHAQETSKNASVQTPAKSETSVVSTGR
TRDTTCHRSHGIGHIARDCPNRRALFVNADGEYTSASDCDDEYALATTNHAGGQDNDDIE
KVHLHPESLDQYPSLIVKLALSAKEKCEEQNQRHNLFQSKVLVKGHTVKMIIDSGSCNNL
ASEEMVKKLGLTTHPHPHPYHIQWFNTCGKMKEYEDVFHDEIPPRMANGRESAHNQEDGI
ESRTTPIQEGEDDEDITSSDTLITSHAPMIIPSPSPVQPPEIALTSNGPSTFMPTPIWCS
LVCIAGMINRASRLWERPCAHAYRINARRGSGVGWIYTGWGEPTGSATAGFRTQRPLTIS
PPDPMVADRSRAHCSRYHLPLEEVERRGGENRKWKIGVAERIRRGMGERIQRYFTEERVD
AGLVG
Download sequence
Identical sequences Q2R0Y9
LOC_Os11g40940.1|PACid:21944362 39947.LOC_Os11g40940.1 LOC_Os11g40940.1|13111.m04060|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]