SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g41140.1|13112.m04289|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os12g41140.1|13112.m04289|protein
Domain Number - Region: 359-465
Classification Level Classification E-value
Superfamily PH domain-like 0.0387
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g41140.1|13112.m04289|protein
Sequence length 480
Comment expressed protein
Sequence
MSESGRVTAGGGRGELRPPELPRDPALEFLSRSWSASGAADVSRRALAAAAFPAAAASAA
VIAEDVSGELDVDGSASGSSFSFASAATSQLIMDRIMSQSQEVSPLTSGRLSHSSGPLNG
GGSLSDSPPVSPDVDDSKFCRAVSTPKPQPYRGVVGGGGKTVGRWLKERKEKKKEEARAH
NAQVHAAVSVAAVAAAVAAVAAATAASGGGRDDRAARTDMAVASAATLVAAQCVEAAESL
GAERDHLAAAIASAVNVRTPGDIVTITAAAATALRGAATLKARALKDVWNVAAVIPVEKN
AIAAATTGGGHHKHNAQKQQHHHRHHGNGSNTSSSFSDEVAAVDDDDDDDNNFLTICSQE
LLARGTELLKRTRKGALHWKVVSVYIHRTGVVMLKMKSRHVAGTLTKKKKNVVVDVCRDV
AAWPGRHLLEGGEHRRYFGLRTAEHRVIEFECGSQREHDMWTKGVARLLATIDGRRKRFA
Download sequence
Identical sequences LOC_Os12g41140.1|PACid:21935080 LOC_Os12g41140.1|13112.m04289|protein XP_015618655.1.37577 39947.LOC_Os12g41140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]