SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g40330.2|13101.m04127|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os01g40330.2|13101.m04127|protein
Domain Number - Region: 140-177
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00654
Family Formin homology 2 domain (FH2 domain) 0.036
Further Details:      
 
Domain Number - Region: 461-549
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0199
Family FCH domain 0.079
Further Details:      
 
Domain Number - Region: 268-311
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0615
Family Troponin T 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g40330.2|13101.m04127|protein
Sequence length 582
Comment DUF630/DUF632 domains containing protein, putative, expressed
Sequence
MTSSLPPSPRPPPPLPFSPIVIRRKKRDGELDEDDSTDDDDDTDSCSTPLPPPPPPGVEW
EYLEPFAMRPLNFPSSLADRIDKEAASQVTMDDDNWVETNTEFDGYDDESVSGNVEGIVS
SVQLNQAKSRALGDDNSSMVSWVTKDSDTSAMAWRSKKSLAGIAKEIDEYFLKAAASGSD
IVILLDSSGGQPDPSELEANRGAGKNSKSAKVFSTISWSWSFKSAQANRQSSMHSSDASG
YGYHGKTLEKLYEEEQKLYKLVKDEEFARLQYRKNTSLLQRLESGDHDKLHAEKVRDNIE
ELQARIISLEEAVGLTCLSISKLRDEELYPQIIELSAGLVHMWRNMYECHQVQNHIAQQA
NLLGNLPGNEPTTDTHCQATSQLEVEVSAWHSSFCNLITLQRDYVTILNQWIKLTDCLPD
NDGFMKSSSGIRSLCAELQRALTGLPEKVAAEAIKTFLSVIHTIVVQQTEERQLKKKSDQ
IESKFHTQLEKHSNNATQNSGQPTLAKLDTFKKQVEEEKARYLNSVRTSRAMTLNNLQTS
LPNVFHALMGFSGVCVQAFEGISRCSEIVASHSGAVSPAISS
Download sequence
Identical sequences LOC_Os01g40330.2|PACid:21905871 LOC_Os01g40330.2|13101.m04127|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]