SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g56550.2|13101.m05990|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g56550.2|13101.m05990|protein
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 2.62e-23
Family Rap30/74 interaction domains 0.0051
Further Details:      
 
Domain Number 2 Region: 200-266
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.12e-20
Family DNA-binding domain from rap30 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g56550.2|13101.m05990|protein
Sequence length 276
Comment transcription initiation factor IIF beta subunit, putative, expressed
Sequence
MAEEAKNLETARADRSVWLMKCPTVVSRAWQEAATAAASSSSSSDAAAGANSNSNANPNP
VVAKVIVSLDPLRSEDQQLQFKMEMAQTGNGNTPKSYSLNMFKDFVPMCVFSESNQGKLS
CEGKVGHKFDMEPHSDNLVNYGKLCRERTQKSMIKNRKLMVLANDNGMSMRPLPGLVGLM
SSGPKKEKKPLPVKPSDMKRTRRDRRELENILFKLFERQPNWSLKNLMQETDQPEQFLKE
ILNDLCFYNKRGPNQGTHELKPEYKKSTEDADATAT
Download sequence
Identical sequences LOC_Os01g56550.2|13101.m05990|protein XP_015629903.1.37577 LOC_Os01g56550.2|PACid:21909993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]