SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g61020.1|13101.m06495|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g61020.1|13101.m06495|protein
Domain Number 1 Region: 87-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-19
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g61020.1|13101.m06495|protein
Sequence length 516
Comment curculin-like lectin family protein, putative
Sequence
MAMAPRCTLSVLLPVALLLCAAIASPDFPLGKNFTVPLYYQQPADLAVTTTTVLNASHGA
PLRPGVAAAISVVAGTGGLEGLSMCSLVVLLGNVTVWASDHDGGRFLVRGFCRLELTVDG
DLRLTDAAGTVGWSSATAGRRAKVLRLTRSGNLRLLDAKNQYVWQSFDKPADKLLRGQRI
GVPSYLTAPVTMIGSAFFSLELKERSITANFNVGIKRYTYWELTPRHNRSVAFAEMDVLG
LRLLDRQRRPVAQISPAIEAQVSFLALGEDGNLGMYFYDSHDMKFGPSYEALGFCELPLA
CGLRGVCSAAGECDDFSTYGVHPAPAAHRHSACNATTVADRHYMAVMEGVTTAIRPASPP
TANVTMRQCADSCLRDCSCAAALYVLAAVADHGGACSRYEMTAGAREVIGGGHRHNYLYL
VKAPRTRDSEHEHGDDDGAVSRVLTRILIGFGTLDVIGLCALTWLCAYYCIYLRDIPVLD
DKDDEEADDEGGEAARRGDAVSQSPPTNSEPVIELN
Download sequence
Identical sequences A0A0E0N4D3 Q94D96
39947.LOC_Os01g61020.1 LOC_Os01g61020.1|PACid:21903358 LOC_Os01g61020.1|13101.m06495|protein XP_015639671.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]