SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g65030.1|13101.m07018|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g65030.1|13101.m07018|protein
Domain Number 1 Region: 74-168,200-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-28
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g65030.1|13101.m07018|protein
Sequence length 428
Comment S-locus-specific glycoprotein precursor, putative, expressed
Sequence
MASSGAPLCSSALVLLPCLFVIAMAALQSGVVVLADAADTVAADRPLSGRQRPLVSNRGK
FALGFFQPENSEHWYLGTWYYQISKHTPVWVANRGSPISNPDTSQLTIATDGNMVLLDNS
TTAIWSTNISNFTSNSTVGVILDSGNLVLADASNTSIILWQSFDHFGDTWLPGGKLGRNK
LTGVSTRLVAWKARNDPVPGVFSLELDPNGTSQYLLQWNSTLQYWTSGNWTGRIFTGVPE
MTPTGSYPNSLYTFDYVNGENESYFVYDLKDDSVLTRFVLGEMGQIQFLTWMNGANDWML
FWSQPKAQCDVYSLCGPFSVCTENAMASCSCLRGFGEQNVGEWLQGDHTSGCRRNVELQC
SSNGSVVGRSTDRFYTMANVRLPSDAESVVAAGIDQCEEACLSNVLALPTPTMAAAHCGT
ETSSTCKM
Download sequence
Identical sequences LOC_Os01g65030.1|13101.m07018|protein LOC_Os01g65030.1|PACid:21910818 39947.LOC_Os01g65030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]