SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g65230.1|13101.m07044|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g65230.1|13101.m07044|protein
Domain Number 1 Region: 41-341
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-85
Family Protein kinases, catalytic subunit 0.000000407
Further Details:      
 
Domain Number 2 Region: 311-331,378-497
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-25
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g65230.1|13101.m07044|protein
Sequence length 498
Comment AGC_AGC_other_PDK1_Pk61C.1 - ACG kinases include homologs to PKA, PKG and PKC, expressed
Sequence
MAVGGDDDMERDFAARLRLAPSPASPNAAAGGGGGGIAFRAPQEQFTVGDFELGKIYGVG
SYSKVVRAKKKDTGNVYALKIMDKKFITKENKISYVKMERIVLDQLDHPGVIRLFFTFQD
TYSLYMALESCEGGELFDQIVRKGRLSEDEARFYAAEIVDILEYLHSLGLIHRDVKPENL
LLTSDGHIKIADFGSVKPTKDTPIKVLPNSTNERACTFVGTAAYVPPEVLNSAPPTFGND
LWALGCTLYQLLSGSSPFKDASEWLIFQRIIARDLKIPEYFSDDARDLIDKLLDVDPSKR
PGAGPDGYVSLKKHPFFRGIDWKNIRSTRAPKLAMEANANEDEDSQDSSWLSHMGSAPVN
QHVSPVGNDGASSSSEVRSHISRLASIDSFDSRWQDFLEPGESVVLISKLKKINKLTNKK
VQLILTDKPQLICVDPGKMVTKGNIMWSDDPSELNVQVSNSSHFRICTPKKVSSFEDAKQ
RAWQWKKAIEDLQRCQKN
Download sequence
Identical sequences Q8RUE8
LOC_Os01g65230.1|PACid:21904761 XP_015622220.1.37577 39947.LOC_Os01g65230.1 LOC_Os01g65230.1|13101.m07044|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]