SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g72810.1|13101.m07936|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g72810.1|13101.m07936|protein
Domain Number 1 Region: 110-236
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.16e-25
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  LOC_Os01g72810.1|13101.m07936|protein
Domain Number - Region: 212-344
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00212
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g72810.1|13101.m07936|protein
Sequence length 463
Comment secreted glycoprotein, putative, expressed
Sequence
MRHAALLGVGFALCLLRAQAQPYDYPTAKPSTTWANTDAALRHHVAYTDGSVARAALLRL
NPARLGPSFAFGFFCTNHRAGAPCADFLLGVAVVYCNSGAGITAVTTGIPQVVWSANRAA
PVGDGATAELTADGDLVLRSPGGKVLWSAGAAGRGVSGMSINSDGNLVLFDGSNRTVWQS
FDHPTDTLVVGQSLKQGARLTANASFDNSSEGRIYLAVADDGLAAYVDAKPPQRYYVLGY
SKNAGAYAAYTNGSLAVLDRPGGQQLATVQLPAVAAGTVQYMRLEHDGHLRLYEWRSNGM
RWEATGDVLHPYPGDCAYPTVCGAYGVCTDMQCSCPDAANFRAVDFRRPNRGCVPTSPPA
PPATCRSRRARHRLVSLRDTAYFNSHDTSMRTLERVGEAACKAACLGDCACMAAQFVYGF
DPNDGFCYLQSEVLSLETMQPEVFHYNSSMHIKIAQGRLPRRF
Download sequence
Identical sequences A2WZA3 Q5JK65
OsIBCD037239 LOC_Os01g72810.1|13101.m07936|protein LOC_Os01g72810.1|PACid:21904935 39946.BGIOSIBCE005066 39947.LOC_Os01g72810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]