SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g06720.1|13102.m00748|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g06720.1|13102.m00748|protein
Domain Number 1 Region: 399-692
Classification Level Classification E-value
Superfamily BEACH domain 9.29e-124
Family BEACH domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 795-1059
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.69e-40
Family WD40-repeat 0.009
Further Details:      
 
Domain Number 3 Region: 234-285,326-378
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-19
Family PreBEACH PH-like domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g06720.1|13102.m00748|protein
Sequence length 1075
Comment WD domain containing protein, putative, expressed
Sequence
MFGAFQAADEVKYMKDAKADRLRQLQELHSKIDESLIEDIEQLQSFEDDIQFAKSAAISV
DDSRKAALQLAFDEDQQIIADKWIHIFRALSEERGPWSANPFPNSTVTYWKLDKTEDKWR
RRLKLKRNYKFDERLCQPPSKFSNESNASSVNPSVSAKIPEKMKHLLLKGVRGITGDVSS
EPCEDNNDMSEPSQNTLSETQGSSDAADSSGYSTSVQNRKEPVSTGGDDDYAAILSSVQC
VLVTPKRKLAGQLTITQKALHFSFEFLVEGTGGTSVFNRYQEKDSDPKNDLGGAEKLKGS
LDGGRGNATESGDALMKNTSNNIKHHRRWKISRIKAVHWTRYLLQYTATEIFFDDANAPV
FLNFSSQNDAKNIGSLLVSLRNDALFPKGSTKDKNSVISFVDRKVALEMAESARESWRRR
EMSNFEYLMILNTLAGRSYNDLTQYPIFPWILSDYSSEKIDFNKSSSFRDLSKPVGALDA
KRFKVFEERYLNFCDPDIPSFYYGSHYSSMGIVLYYLLRLEPFTALHRNLQGGKFDHADR
LFQSIESTYRNCLSNTSDVKELIPEFFYMPEFLENSNSYHLGVKQDGEPLGNVGLPPWAK
GCPEEFIHINREALESEYVSSNLHHWIDLIFGYKQRGKPAVEAANIFYYLTYEGAVDLEN
MDDMLQKSAIEDQIANFGQTPIQIFRKKHPRRGPPIPIAHPLYFAPQSITVTSVVPSSSS
SSSPVLFVSLLDSNIVVMNEGLVLSVKLWLTTQLQSGGNFTFSGSLEPFFGIGSDVISPR
KISTSLAENVDFGRQCLTAVQIHGDNYLILCGNWENSFQIISLGDGRIVQSVRQHKDVVS
CVAVSSDGSVIATGSYDTTVMIWHAFRGKSADKKSRNANYDLSTKDHVIIESPYHILCGH
DDIITCLFVSTELDIVISGSKDGTCIFHTLREGKYVRSIRHPSGAGLSKLVASQHGRLVF
YSDSDLSLHMYSINGKHIASSEANGRLNCMELSCCGEFVVCAGDHGQIVLRSMHSLDVVW
RYEGAGKTITSLVVTPEECFLAGTKDGSLIVFSIENPLIRKGTVQRNKIKSSVGG
Download sequence
Identical sequences LOC_Os02g06720.1|PACid:21918462 39947.LOC_Os02g06720.1 LOC_Os02g06720.1|13102.m00748|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]