SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g10080.1|13102.m01114|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g10080.1|13102.m01114|protein
Domain Number 1 Region: 161-240
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000253
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 265-295
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000432
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000196
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 34-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000068
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g10080.1|13102.m01114|protein
Sequence length 300
Comment zinc finger C-x8-C-x5-C-x3-H type family protein, expressed
Sequence
MEVGGRKRGKPDGANGAGGKRARESESFQTGVGSKSKPCTKFFSTSGCPFGEGCHFLHHF
PGGYQAVAKMTNLGGPAIAPPPGRMPMGNAVPDGPPTPTVKTRLCNKYNTAEGCKWGDKC
HFAHGERELGKPMLMDSSMPPPMGPRPTGHFAPPPMPSPAMSTPASFGASATAKISVDAS
LAGGIIGRGGVNTKQISRVTGAKLAIRDHESDTNLKNIELEGTFDQIKNASAMVRELIVS
IGGGAPPQGKKPVGGSHRGGGPGSNFKTKLCENFTKGSCTFGDRCHFAHGENELRKSAAA
Download sequence
Identical sequences A0A0E0G383 A0A0E0NB44 A2X1Z0 Q7F8R0
ONIVA02G08800.1 39946.BGIOSIBCE005985 39947.LOC_Os02g10080.1 OsIBCD005387 LOC_Os02g10080.1|PACid:21924544 LOC_Os02g10080.1|13102.m01114|protein XP_015626985.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]