SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g32620.1|13102.m03533|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g32620.1|13102.m03533|protein
Domain Number 1 Region: 89-172,240-261
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000132
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  LOC_Os02g32620.1|13102.m03533|protein
Domain Number - Region: 385-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Pan module (APPLE domain) 0.087
Further Details:      
 
Domain Number - Region: 238-300
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0226
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g32620.1|13102.m03533|protein
Sequence length 522
Comment PAN domain-containing protein At5g03700 precursor, putative, expressed
Sequence
MEAVRCFVVLCVAVAAALASLGGGAVDAAAAAAAAQEMRRGFSAAHDRSYSQFEQVLSDP
TGVFALGFLRVNSTMLDLAVVHLPSSFPLWSSIPDRPAQWSAPASLSFDGDLVLTDPAAN
KVLWSAGAAAGAGGDRVVLLNTSNLQIQSGGGGGDGGSSPGIVWQSFDAPSETIVQGQNL
TSAAALYTSDRRFSMRMGTSYFGLYIEPPASSSGGGGVAAAMYWKHTALQAKAAIVDGGG
PTYARVEPDGYLAMYQKEGPPAEVLSFDTFNHGVRALRRMTLEADGNLRAYYWDSTGSRW
VLDYTAITDPCGLPSTCGAYAVCVPPSGRCACLANATDGSGCAAANVGGGGGLCGRTGGE
VGGLYWEVRRQRVEPANKEFLPFEHSPSAADCEVRCARNCSCWGAVYSNGTGYCYLMDYP
AQMMVAADERKVGYFKVRSLEEAAAASGGGRAAGVKAALLAVGVTVLVAAAAFGAYRVWK
RRCRTAVDARRQVVADDEGLSPGPYKNLGSFSSVELSSSFRR
Download sequence
Identical sequences A0A0E0NFS2 Q6H6Q2
39947.LOC_Os02g32620.1 XP_015625805.1.37577 LOC_Os02g32620.1|PACid:21918400 LOC_Os02g32620.1|13102.m03533|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]