SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g35130.1|13102.m03810|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g35130.1|13102.m03810|protein
Domain Number 1 Region: 16-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.85e-26
Family G proteins 0.0062
Further Details:      
 
Weak hits

Sequence:  LOC_Os02g35130.1|13102.m03810|protein
Domain Number - Region: 180-321
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0691
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g35130.1|13102.m03810|protein
Sequence length 330
Comment AIG1, putative, expressed
Sequence
MGGSEYDDDWELPSADITVVLCGKLGCGKSATGNSIVGREAFVSEYSHASVTSTCQLAST
ALKDGRTLNVIDTPGLFEMTITSEDAGKEIVKCMSMAKDGIHAVLMVFSATSRFTREDSS
TIETIKEFFGEKIVDHMILVFTYGDLVGENKLKSMLNNAPEYLQKTVELCKNRVVLFDNM
TKDRWLQEKQLENLLDVVDSVNTNNGGKPFSDQMLACIKEAHAREQEVHDAIGYTEEQIS
ELKKEIQRTRDEQLANITNMVEEKLNITVDKLQQQLMEEQNARLEAERLAAEARLRSDEE
IRKLKKRLEKAQQENEEFRKMASQHKCSIL
Download sequence
Identical sequences A0A0D9YTN7 A0A0E0NGE3 I1P1B0 Q6YVY1
LOC_Os02g35130.1|PACid:21920622 LOC_Os02g35130.2|PACid:21920623 OGLUM02G20870.1 ORGLA02G0176600.1 39947.LOC_Os02g35130.2 XP_015627137.1.37577 XP_015627138.1.37577 LOC_Os02g35130.1|13102.m03810|protein LOC_Os02g35130.2|13102.m03811|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]