SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g40340.2|13102.m04493|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g40340.2|13102.m04493|protein
Domain Number 1 Region: 29-124,207-358
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 2.04e-37
Family Plant cytotoxins 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g40340.2|13102.m04493|protein
Sequence length 383
Comment expressed protein
Sequence
MDYQQSDGIYDMPDEPLFTLNLRLSHSNDLDRVHKSFTSKIDKARTYLTGRFRRIVKVKG
SKRKEFVLTPEGPDVFTIAFTDGTNRVTAIIEERNMWLRGFQTADGHIFEFNDEHGNEGK
DANLDDKTDEMNNQFNGNDKTRDEEVKDEEEAIKDQKLKVIKDPKMKAIKDRGMNKHCKQ
KEKSKAACGSKKKQVNRKDQLNPKKYIRGSVLLRHDSNYGSLLGPNRLPLFQVVYSTMRD
MLQNLAHFDPNNYSDKHKRSMAALIIHTAETLKNKYISSLVLNSFNPHIGARLQALDDMG
AAHINGWSTASELILKSIHLPSKVWDFQQQEFSKCNEFYKNQCWTTDPNVAMKSIVFLKG
DAYTDSKLSVKDGDTITISHSLC
Download sequence
Identical sequences Q6K8T6
39947.LOC_Os02g40340.1 LOC_Os02g40340.1|13102.m04492|protein LOC_Os02g40340.2|13102.m04493|protein LOC_Os02g40340.1|PACid:21919491 LOC_Os02g40340.2|PACid:21919492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]