SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g40500.1|13102.m04514|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g40500.1|13102.m04514|protein
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-34
Family Thioltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g40500.1|13102.m04514|protein
Sequence length 133
Comment OsGrx_C2.1 - glutaredoxin subgroup I, expressed
Sequence
MGMAQSSSSSSRPSDSEQLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLA
ELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVP
LLTEAGAIATPSL
Download sequence
Identical sequences A0A0E0IKH4 A0A0E0NHU5 I1P291 Q6K953
XP_015626005.1.37577 OsIBCD007238 LOC_Os02g40500.1|PACid:21920399 ONIVA09G12430.1 39946.BGIOSIBCE007836 39947.LOC_Os02g40500.1 LOC_Os02g40500.1|13102.m04514|protein ORGLA02G0209700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]