SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g46340.1|13103.m04986|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g46340.1|13103.m04986|protein
Domain Number 1 Region: 30-130
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-16
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g46340.1|13103.m04986|protein
Domain Number - Region: 261-305
Classification Level Classification E-value
Superfamily BAS1536-like 0.0471
Family BAS1536-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g46340.1|13103.m04986|protein
Sequence length 500
Comment pleckstrin homology domain-containing protein, putative, expressed
Sequence
MATNGSSPRARETESSLEKVKRQLSSGSGRYLLQGPLLKRSETLRKWNERWVILDPTSGK
MEYKIRRNETAIKGTIIFDASSTITLSPVNFQGMPKYDGCCFYIGTPQKKDYFLCAETPG
AAKAWVSTLLATQLVLQAHKEAVNSLAGNGSPATLGTVATAVANANATALEATKEIEAAM
KVSMRAALGLGANNPKEGQLDDLTIMKETLRVKDEELQNLAKDIRARDATIKEIANKLTE
TAEAAEAAASAAHTMDEQRRLLCSEIERLRQAMERQMEQSMLKLRQSEEKVISLSKEKDQ
LLKERDAALQEAHMWRTELGKAREQAVIQEATIARADEKVRASEADAAARIKEAAEKLHA
VEKEKEELLSLVGILQSQVQREQSSTKQVCEERSESCSGTDNSPPLTKHVDASDDDVDKA
CVSDSRSVLVSNDNTEVQLAVDGVDIRPIGDAEWGSFQQSEALIADVREVSPESEGGSLD
IPVVNPPPVSDHIQGGATHP
Download sequence
Identical sequences B8ANN2 Q75H96
LOC_Os03g46340.1|13103.m04986|protein 39947.LOC_Os03g46340.1 LOC_Os03g46340.1|PACid:21914493 XP_015630802.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]