SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g51710.1|13105.m05590|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g51710.1|13105.m05590|protein
Domain Number 1 Region: 112-227
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000101
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g51710.1|13105.m05590|protein
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0392
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g51710.1|13105.m05590|protein
Sequence length 250
Comment pleckstrin homology domain-containing protein-related taxo, putative, expressed
Sequence
MDDVYGRIEVFPQHFLPSQQSMETPADGLSTSKTNLDSPPSSRRRSWTPKRVMGAASLLH
LLSLPRIRWSSSTEDDDKIELTRAEVESLRTEIADAEERESQLKARLENIDEVLRYARLS
GYLYIRSRWTQLPGEPPILDDADVDDWLPRFVVLQGQCVYYYLKSTDLSPQESTLLCDIV
EVGQLPNFVPEDEKTRYAFYIMTSQGLKFECSSMSEIQVDSWVRAIRGDCGLSDGGESRS
KTSRQEVGSW
Download sequence
Identical sequences A2Y866 I1PYK4 Q5KQH1
39947.LOC_Os05g51710.1 LOC_Os05g51710.1|PACid:21942620 LOC_Os05g51710.1|13105.m05590|protein ORGLA05G0245200.1 XP_015639334.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]