SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g41384.2|13106.m10558|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g41384.2|13106.m10558|protein
Domain Number 1 Region: 168-260
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 259-290
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000497
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000445
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 34-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000353
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g41384.2|13106.m10558|protein
Sequence length 295
Comment zinc finger C-x8-C-x5-C-x3-H type family protein, expressed
Sequence
MEAGGGKRAAPEGTNGAAKRARASESSQVGVGSKLKPCTKFFSTSGCPFGSSCHFLHNFP
GGYQAAAKMTSHGGTAVAAPPGRMPLGPGAPNGPPTSSVKTRMCNKYNTAEGCKWGSKCH
FAHGERELGKPMLLDNSMPHPMGSMPFEAPPMPGPDIVPPSTFGASATAKISVDASLAGG
IIGKGGTNTKHISRMTGAKLAIRDNESNPNLKNIELEGTFDQIKHASAMVTELIVRISGN
APPAKNPGRGSHAGGPGSNFKTKLCENFNKGSCTFGDRCHFAHGESELRKPPAAA
Download sequence
Identical sequences I1Q3P4 Q69XQ3
LOC_Os06g41384.1|PACid:21930419 LOC_Os06g41384.2|PACid:21930420 LOC_Os06g41384.1|13106.m04320|protein LOC_Os06g41384.2|13106.m10558|protein 39947.LOC_Os06g41384.2 XP_015641069.1.37577 ORGLA06G0175700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]