SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g37810.1|13109.m03754|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g37810.1|13109.m03754|protein
Domain Number 1 Region: 60-160,193-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.07e-28
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  LOC_Os09g37810.1|13109.m03754|protein
Domain Number - Region: 359-399
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00942
Family Anti-platelet protein 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g37810.1|13109.m03754|protein
Sequence length 468
Comment S-locus-specific glycoprotein precursor, putative
Sequence
MNWIAFNYLTTAIFLLLLPACVADDQLVPGKPLSIGSTVVSNGGAFALGFFSPTNSTSSN
LYLGIWYNDISPLTLVWVANRGTPVKDGGHGSSSSAPSLTLSNSSGLVLADGDGRVLWTT
DITIIAANSPAVAVLMNTGNLVVRSPNGATLWQSFDHPTDTYLPGMKIGINYRTRVGERL
LSWNDGPGDPSPGSFSFGGDPDTFLQLFIWNQSRPYWRSPVWTGNPIPSQLMVNGTTVIY
LSVVDADDEIYLSFGISDRAPRTRYVLTNSGKLQVLSWDGGDGASEWSKLGELPKYECEH
YGYCGPYGYCYYSEVAPTCECLDGFEPRSKEEWSNGRFSRGCRRTEELPCGGDGGDAVFL
EMQGMQLPDKFVRVRNKTFHECAAECAGDCSCTAYAYANLGGSGSARKDATRCLVWLGEL
IDTQKVGPDWVPWGIVGGETLYLKAAGFTGLKSRRISGRSLYVSFRVA
Download sequence
Identical sequences LOC_Os09g37810.1|PACid:21926734 LOC_Os09g37810.1|13109.m03754|protein 39947.LOC_Os09g37810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]