SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g24050.1|13110.m02007|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g24050.1|13110.m02007|protein
Domain Number 1 Region: 142-363
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 4.45e-44
Family Plant cytotoxins 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g24050.1|13110.m02007|protein
Sequence length 367
Comment ribosome inactivating protein, putative, expressed
Sequence
MARWSDRAGTGLTPDGPCRAWARPKRRAVGRAVGPRAFCPSIHVGRSSLVSQSNPLMSNP
RNLSMKMMLAGVPSLNNDDHRRRGHGRSDLITVKVMAILPLLISTPAHSIGGVVDDDDDV
EYVEITCYIDTQPFDYCFEQAYLLLSDNEPRKTVHGNHPVLAPKRKGQDTFTAPPRKWLK
MHLVCRKPRIDRCTIALRFDTIYLMAFSTNQNQWYSMYSGFPIAHTRLPFDEDYFALAGG
TSNLVTVPLGKESALDAIHTLATFDGESANDLKIPLVKLRIMFSEALKLKPVRLAFSRDW
NEETHITKQDANYIGCWGLMSFNLVAWKNSGYAYWKSEKKLENCLVNTPWNASEVGDLLM
RPNDEAI
Download sequence
Identical sequences Q7G6L7
LOC_Os10g24050.1|PACid:21885965 LOC_Os10g24050.1|13110.m02007|protein 39947.LOC_Os10g24050.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]