SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g34390.1|13110.m03060|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g34390.1|13110.m03060|protein
Domain Number 1 Region: 1096-1247
Classification Level Classification E-value
Superfamily VC0467-like 1.83e-23
Family VC0467-like 0.0017
Further Details:      
 
Domain Number 2 Region: 912-951,979-1042
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000196
Family PDI-like 0.0087
Further Details:      
 
Weak hits

Sequence:  LOC_Os10g34390.1|13110.m03060|protein
Domain Number - Region: 43-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0043
Family PDI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g34390.1|13110.m03060|protein
Sequence length 1252
Comment expressed protein
Sequence
MRLPLLGAALPLLLSLLAASQLGASATAAAASSGAAASGRAEWQVLTRANFSSQIRLHPH
ILLVVTMPWYGESRSLMAEIELLVAADEQELGHLKLMAVYRNSEKLLTDVLGATEGIKFI
YYQRSLPFKYEGKLRAREILSSVHYIMSLKHAEAPFVVLHTKEDVEAFVESTDKAVVLSE
FCGWFSKLAHGGSNRTEGTSSKNHTENVDISGKALTGESDGPLELVIEDEELIFGGGVQL
AGSPWKGGFTLANGSMSDQNGITTDENRKLCTAEKLQQFESFYAKLTALSRDYFLPPEKV
RFGLITERSSLPSSEFINEGNSETWFLSVHYLGCTNCSIVAKEGDDLRSLLQSYHNLNIN
EMDIDASGIATFPASRSSAILFIDRLSDSSKVRDESKLSLKLLREYVQKNYPSHFSTGGL
TSGKSRMSSKAVPSLVSTGRSAHTERTRLNDWASKLMEIGEKMSVMVVNDGESISYRSDS
QGSTDNPLYDILTKLIHKTRPAHRSKKTKISFVAKDVAIKKLSDDSEVQVVESLSIRDSQ
LERNEGSCASSDGGNDDYTEDSVHENRATEAEYINDRQAPIKLEKGPANYCDNNEKHLES
SDTEVEEEHKTKASDVSLDLQEDISVDVHSSNAPKNFCKINKEDLDCSDTKMEEQEHKTE
ASDTSADLQEEVSTDVHSSNEVGHILHKHKDEETVREALDILEPDGTNVNFNQQKSGSAN
QQDAVFSVLGQESRRIEDAIYEDNLFILDEGSEESDSKYPVHAALSSSSSLVGDNTYYTE
QETPSIPDEHFAGSLFFSDGGYRLLQTLTGGSRMPSLVIIDPIQQKHYVFPDEIEFTYPS
LANFLDHFMNRSLSPYYRSALSVISSKELLRPPFINRDFHEADSIPQLTTSNFCMLVFGF
EGCVSKSELPFSNTENISSAWKKDVLVLFSNSWCGFCQRTELVVREVYRSFKNFLSSNSQ
FLQAQDLQIEEKEEESTMKGFPAIYLIDCTSNECHHLLKSVGKEERYPTLLFFPAENKSA
ISYERGISVSNLFEFLESHASNSPHLLEYKGFLWKKKTVVQGDAPQAIQFDNSDKISNDV
GSHSPSHSERNEARVLTGSVLTATSKLGSAVPFDNSQVLIVSADSREGFHGLIINKRLSW
DTFKNLDGSMEPIKHAPLFYGGPVVVQGYYLVSLSRVAFDGYLQVIPGVYYGNVAATAQV
TRRIKSGEQSAENLWFFLGFSNWEYSQLFDELSEGAWQVSEEPIEHLVWPEN
Download sequence
Identical sequences Q7XDA0
LOC_Os10g34390.1|13110.m03060|protein XP_015614169.1.37577 LOC_Os10g34390.1|PACid:21883611 39947.LOC_Os10g34390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]