SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g38590.1|13110.m03514|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g38590.1|13110.m03514|protein
Domain Number 1 Region: 89-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 9-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g38590.1|13110.m03514|protein
Sequence length 240
Comment glutathione S-transferase, N-terminal domain containing protein, expressed
Sequence
MAGAGRDELKLLGMWASPYVSRAKLALQLKGVSYEYIEEDLGNKSDLFLRSNPVHKTVPV
LIHNGNPICESSIIVQYIDESFPSSAASLLPADPYDRAVARFWAAYIDDKLAAPWRMVYR
VKTEEERDELMKQTLAAVDVLEGGLKECSKGKGCFFGGDSVGYVDVVLGGLVSWVHASDK
LSGAKLFDAAKAPLLAAWLGRFGELDAAKAVLQDVDKVVEYAKKFQPRDSGTAADRQAVN
Download sequence
Identical sequences A0A0E0HIB7 A2Z9L2 Q945W9
OsIBCD031284 LOC_Os10g38590.1|PACid:21885522 39946.BGIOSIBCE032849 ONIVA05G27400.1 LOC_Os10g38590.1|13110.m03514|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]