SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g03860.1|13111.m00329|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g03860.1|13111.m00329|protein
Domain Number 1 Region: 78-226
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-22
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g03860.1|13111.m00329|protein
Domain Number - Region: 372-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0114
Family Anti-platelet protein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g03860.1|13111.m00329|protein
Sequence length 570
Comment Ser/Thr protein kinase, putative, expressed
Sequence
MSTSCSGALRAATTKALLLLVVAVFVVSLSRPFPCAAAARDSLLRGASIAVEDHATDVLL
SPDGTFACGFYVVSPTVFTFSVWFARAADRAVVWSANRGRPVHSKRSRLKLNGRRRALVL
TDYDGEVVWNSTVSANATATATAARARLHDSGNLAVEDASGNVLWQSFDHPTDTLLPTQR
IAAGEAMVSADKLLAAGFYSFRFSDYAMLSLVYDNHEMSSIYWPNPYYSYWQNSRKIYNF
TREAFFDASGHFSSSDNATFDASDLAKNVAVRRRLTLDTDGNLRLYSLDEVTGTWSVSWM
AFSNPCIIHGVCGANAVCLYSPAPVCVCAPGYGRAEPSDWSRGCRPTFNSSDDGGQPRAM
KMVPLPHTDFWGFDINSSENLSLDECSTRCMSEPSCVVFQYKQGKGECYPKSLMFNGRTF
PGLPGTAYLKVPADLDMLEIHIHQWQADSDGHGIAAIQEDIVGCGGMSSPEFLLNVSNAS
SSKSNQGKSIWFYFYGFLTAFFVIEVFVIAFGCWLFSNKGVFKPCQVSALDEGYRMVTNH
FRTYSYAELQKGTRKFQSEIGRGGSRCYKM
Download sequence
Identical sequences Q2RAY4
LOC_Os11g03860.1|PACid:21948556 LOC_Os11g03860.1|13111.m00329|protein 39947.LOC_Os11g03860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]