SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g05240.1|13111.m00499|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g05240.1|13111.m00499|protein
Domain Number 1 Region: 91-166,266-291
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000448
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g05240.1|13111.m00499|protein
Domain Number - Region: 373-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Pan module (APPLE domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g05240.1|13111.m00499|protein
Sequence length 507
Comment PAN domain-containing protein At5g03700 precursor, putative
Sequence
MRLDKGDPAIAGVVAALCVASAVMVAVVDGAKGDGRVTQLSNGFTARHSPDAPAPFEPVL
YAANGAFAFGFLRVGAASLDLAVVHLASSFPVWRATPARVGDWSRPATLTFDTGLVLAGA
DDAAGVLWQTLNAIGDTVVLLNSSNLVVRRFAETRPAWQSFDNPSDTLVLDQNLTVSSPP
LISGNRRFALRLAKTYMSLHMEFYGGRATPMYWQHTALEAQPENATQPPVYGCLDGRGFF
GLYLQGSGEKVDVLSFDTFVQNLTGAFRRMTLEDDGNLRAYYWTDDAKAWTADYKAITAP
CELPTSCGAYGLCVPGGGEAKCQCLTNSTATSPPCSAEETTDLCGDGDSDGGQVFDEVRL
KRVSVAYKERLPFEANATAEQCEQACAGNCSCWGAVHSGASGYCYLLDFPVETMVYEADD
RKVGYFKVRRPPRSSTRRGMSPGAKAVTAALSLILASLAVAGAYVGHRLWQRRRRRRRAG
GMEQELTSSGPYKDLKSMGSSNSSFKS
Download sequence
Identical sequences A0A0E0FLY3 A0A0E0R492 A2ZBG9 Q53PX8
XP_015617010.1.37577 ONIVA01G18830.1 OsIBCD045693 39946.BGIOSIBCE033495 39947.LOC_Os11g05240.1 LOC_Os11g05240.1|PACid:21944777 LOC_Os11g05240.1|13111.m00499|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]