SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Ostta4|33410|0600010257 from Ostreococcus tauri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ostta4|33410|0600010257
Domain Number 1 Region: 181-221,254-314
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000828
Family N-utilization substance G protein NusG, N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 369-412
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000722
Family N-utilization substance G protein NusG, C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Ostta4|33410|0600010257
Domain Number - Region: 54-88
Classification Level Classification E-value
Superfamily SAP domain 0.000208
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Ostta4|33410|0600010257
Sequence length 417
Sequence
MSSATVARAWTSAGAPRGRRARERRLRNTPPPRGRARARALDDDDDDDDGRPRVEDMTAR
EMREELRAFDLPTSGRKTSLVALLEKARAWADAGATPRAEWTREAAAERAMEDAARRAAE
ERRMERRERRGYADAGGGRRGGGSVVETTRAVEAMKERGASEARREFVVQRAMSESGAGR
EGWFMLETAENREERAREMILALNGTKLTREQREPLVAWVPRVPRDNFYLTEEDAEGKSE
LELCQMVGEEDMAEMIQPGYVLVRCTLTQTLTDAFNDLWSVRGFATGGSSRFGKKSYEKL
NQPLSMDDQIPRMIRKCVPVVKTDEQVKADEARVEVQEVARAGRQERDENDGDDLRPTSS
SEVGAATYDRIEVHDGPFKGFKGFIVSENDDGSVEATLAIFGRDTNVTLTSDEYKCI
Download sequence
Identical sequences Q016Z5
jgi|Ostta4|33410|0600010257 70448.Q016Z5 XP_003079870.1.19543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]