SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Ostta4|35648|1100010298 from Ostreococcus tauri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ostta4|35648|1100010298
Domain Number 1 Region: 13-559
Classification Level Classification E-value
Superfamily SIS domain 6.18e-184
Family Phosphoglucose isomerase, PGI 0.000000000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Ostta4|35648|1100010298
Sequence length 590
Sequence
MPVVMEAKALISSTEEWRALRSHVEAIDKTHLRDLIRDEARCDALALEYDGLYCDFARQR
VTTETMEKLYDLARAAGVREKVNAMFNGEAINSTENRAVLHVATRAPKDKVINVDGRNVV
PDVHDVLEKIKEFSERVRNGEWIGETGKPLKDVVAIGIGGSFLGPLFVHTALRTNPEAAV
GASGRQLRFLANVDPVDVARSLNGLDPETTLVIVVSKTFTTAETMLNARTVRAWIRASLG
ENAVQKHMVAISTNLKLVKEFGIDPDNAFAFWDWVGGRYSVCSAVGMLPLSLQYGYDTME
KFLEGAWSMDQHFANAPFEENLPVTLGMLSVWNVSFLGCPARAILPYCQALAKLAPHIQQ
VAMESNGKGVAIDGTPLDYDTGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIVKSQQS
VYLKGEIVSNHDELMCNFFAQADALAVGKSAVELRSENVPDALIPHKTFSGNRPSLSIML
PELNAYTTGQLLSLYEHRVAVQGFVWGINSFDQWGVELGKVLASRVRATMNDKRTKGETM
SGGEGYNPSTTRLLNRYLAGKAKLIYPEPKDVFPCDLIDSDECRPPTSYV
Download sequence
Identical sequences jgi|Ostta4|35648|1100010298 XP_003082100.1.19543 70448.Q00YK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]